DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp3 and Igf1

DIOPT Version :9

Sequence 1:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_006513318.1 Gene:Igf1 / 16000 MGIID:96432 Length:197 Species:Mus musculus


Alignment Length:105 Identity:29/105 - (27%)
Similarity:42/105 - (40%) Gaps:28/105 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SLLLLILMIGGVQATMKLCGRKLPETLSKLC-VYGFNAMTKRTLDPVNFNQIDGFEDRSLLERLL 79
            :|.||............|||.:|.:.|..:| ..||           .||:..|:          
Mouse    74 ALCLLTFTSSTTAGPETLCGAELVDALQFVCGPRGF-----------YFNKPTGY---------- 117

  Fly    80 SDSSVQMLKTRRLRDGVFDECCLKSCTMDEVLRYCA-AKP 118
             .||::    |..:.|:.||||.:||.:..:..||| .||
Mouse   118 -GSSIR----RAPQTGIVDECCFRSCDLRRLEMYCAPLKP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 21/81 (26%)
Igf1XP_006513318.1 IlGF 87..154 CDD:239834 26/92 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.