DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and Ilp1

DIOPT Version :10

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster


Alignment Length:140 Identity:33/140 - (23%)
Similarity:59/140 - (42%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MVAVILLASSTVKLAQGT-----------LCSEKLNEVLSMVCEEYNPVIPHKR--AMPGADSDL 61
            ::|.:|.|:..:....|:           ||...|::.:.:||......:|.||  .:..:|.|.
  Fly    19 LIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDE 83

  Fly    62 DALNPLQFVQEFEEEDNSISEPLRSALFPGS-YLGGVLNSLAEVRRRTRQRQ---GIVERCCKKS 122
            |....:|       :|:|:.:.|..|.:..| .|..:..|...::.|..:|.   |:.:.||.|:
  Fly    84 DTEQEVQ-------DDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKT 141

  Fly   123 CDMKALREYC 132
            |....|..||
  Fly   142 CSYLELAIYC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 7/23 (30%)
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 6/19 (32%)

Return to query results.
Submit another query.