DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and Ilp1

DIOPT Version :9

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster


Alignment Length:140 Identity:33/140 - (23%)
Similarity:59/140 - (42%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MVAVILLASSTVKLAQGT-----------LCSEKLNEVLSMVCEEYNPVIPHKR--AMPGADSDL 61
            ::|.:|.|:..:....|:           ||...|::.:.:||......:|.||  .:..:|.|.
  Fly    19 LIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDE 83

  Fly    62 DALNPLQFVQEFEEEDNSISEPLRSALFPGS-YLGGVLNSLAEVRRRTRQRQ---GIVERCCKKS 122
            |....:|       :|:|:.:.|..|.:..| .|..:..|...::.|..:|.   |:.:.||.|:
  Fly    84 DTEQEVQ-------DDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKT 141

  Fly   123 CDMKALREYC 132
            |....|..||
  Fly   142 CSYLELAIYC 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 7/23 (30%)
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136481at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13647
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.