DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ilp2 and igf2b

DIOPT Version :9

Sequence 1:	NP_524012.1	Gene:	Ilp2 / 39150	FlyBaseID:	FBgn0036046	Length:	137	Species:	Drosophila melanogaster
Sequence 2:	NP_001001815.1	Gene:	igf2b / 324215	ZFINID:	ZDB-GENE-030131-2935	Length:	212	Species:	Danio rerio

Alignment Length:	124	Identity:	26/124 - (20%)
Similarity:	40/124 - (32%)	Gaps:	50/124 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly    11 VAVILLASSTVKLAQG-TLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDLDALNPLQFVQEFE 74
            :.::.|..|..::|.. |||..:|.:.|..|||:
Zfish    35 ICILFLTLSAFEVASAETLCGGELVDALQFVCED------------------------------- 68

  Fly    75 EEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALREYCS 133
                           .|.|..   ...:....|..|.:||||.||..||::..|.:||:
Zfish    69 ---------------RGFYFS---RPTSRSNSRRSQNRGIVEECCFSSCNLALLEQYCA 109

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ilp2	NP_524012.1	IlGF_insulin_bombyxin_like	<111..132	CDD:239832	9/20 (45%)
igf2b	NP_001001815.1	B domain	46..77		11/79 (14%)
		IlGF	49..115	CDD:239834	23/110 (21%)
		C domain	78..88		2/9 (22%)
		A domain	89..109		10/19 (53%)
		D domain	110..115		26/124 (21%)
		E domain	116..212
		IGF2_C	144..199	CDD:285554
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1644517at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010