DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and Ilp5

DIOPT Version :9

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_996037.2 Gene:Ilp5 / 2768992 FlyBaseID:FBgn0044048 Length:108 Species:Drosophila melanogaster


Alignment Length:133 Identity:37/133 - (27%)
Similarity:54/133 - (40%) Gaps:32/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSFISMVAVILLASSTVKLAQGT----LCSEKLNEVLSMVCEE-YNPVIPHKRAMPGADSDLDAL 64
            :.|.|::.|:|.....:..||..    .|...|.::|.:.|.. :|.:.. ||...|.....|.|
  Fly     1 MMFRSVIPVLLFLIPLLLSAQAANSLRACGPALMDMLRVACPNGFNSMFA-KRGTLGLFDYEDHL 64

  Fly    65 NPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALR 129
            ..|         |:|.|..              :|||:.:||..|   |:|:.||:|||....||
  Fly    65 ADL---------DSSESHH--------------MNSLSSIRRDFR---GVVDSCCRKSCSFSTLR 103

  Fly   130 EYC 132
            .||
  Fly   104 AYC 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 9/20 (45%)
Ilp5NP_996037.2 IlGF_insulin_bombyxin_like 29..106 CDD:239832 29/103 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136481at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13647
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.