DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and Igf2

DIOPT Version :9

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_008758296.1 Gene:Igf2 / 24483 RGDID:2870 Length:326 Species:Rattus norvegicus


Alignment Length:139 Identity:32/139 - (23%)
Similarity:45/139 - (32%) Gaps:60/139 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPLSFISMVAVILLASSTVKLA----QGTLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDL 61
            |..|:....:|.:|.||.:...:|    ..|||..:|.:.|..||.:                  
  Rat   165 MGIPVGKSMLVLLISLAFALCCIAAYRPSETLCGGELVDTLQFVCSD------------------ 211

  Fly    62 DALNPLQFVQEFEEEDNSISEPLRSALF--PGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCD 124
                                   |...|  |.|             |..|:.:||||.||.:|||
  Rat   212 -----------------------RGFYFSRPSS-------------RANRRSRGIVEECCFRSCD 240

  Fly   125 MKALREYCS 133
            :..|..||:
  Rat   241 LALLETYCA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 10/20 (50%)
Igf2XP_008758296.1 IlGF 192..255 CDD:239834 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.