DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and ins-1

DIOPT Version :9

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_501926.1 Gene:ins-1 / 177936 WormBaseID:WBGene00002084 Length:109 Species:Caenorhabditis elegans


Alignment Length:132 Identity:29/132 - (21%)
Similarity:45/132 - (34%) Gaps:39/132 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KPLSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEY--NPVIPHKRAMPGADSDLDALN 65
            :|..|...:|::||:|.|...|...||..:|...|..||...  ..:...||:            
 Worm     9 RPSFFFGFLAILLLSSPTPSDASIRLCGSRLTTTLLAVCRNQLCTGLTAFKRS------------ 61

  Fly    66 PLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALRE 130
                      .|.|.:...|              .|..:..: ::|.||...||:|.|....|:.
 Worm    62 ----------ADQSYAPTTR--------------DLFHIHHQ-QKRGGIATECCEKRCSFAYLKT 101

  Fly   131 YC 132
            :|
 Worm   102 FC 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 8/20 (40%)
ins-1NP_501926.1 IlGF_insulin_bombyxin_like 34..103 CDD:239832 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13647
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.