DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and Igf2

DIOPT Version :9

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:NP_034644.2 Gene:Igf2 / 16002 MGIID:96434 Length:191 Species:Mus musculus


Alignment Length:139 Identity:32/139 - (23%)
Similarity:45/139 - (32%) Gaps:60/139 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPLSFISMVAVILLASSTVKLAQ----GTLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDL 61
            |..|:....:|.:|.||.:...:|.    .|||..:|.:.|..||.:                  
Mouse    12 MGIPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSD------------------ 58

  Fly    62 DALNPLQFVQEFEEEDNSISEPLRSALF--PGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCD 124
                                   |...|  |.|             |..|:.:||||.||.:|||
Mouse    59 -----------------------RGFYFSRPSS-------------RANRRSRGIVEECCFRSCD 87

  Fly   125 MKALREYCS 133
            :..|..||:
Mouse    88 LALLETYCA 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 10/20 (50%)
Igf2NP_034644.2 IlGF 39..102 CDD:239834 25/112 (22%)
IGF2_C 123..177 CDD:285554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.