DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and Igf1

DIOPT Version :10

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_006513318.1 Gene:Igf1 / 16000 MGIID:96432 Length:197 Species:Mus musculus


Alignment Length:136 Identity:32/136 - (23%)
Similarity:46/136 - (33%) Gaps:49/136 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPLSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDLDALN 65
            ||....|...:.::...|||. ....|||..:|.:.|..||                       .
Mouse    65 MSSSHLFYLALCLLTFTSSTT-AGPETLCGAELVDALQFVC-----------------------G 105

  Fly    66 PLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALRE 130
            |..|.  |.:              |..|...:        ||..| .|||:.||.:|||::.|..
Mouse   106 PRGFY--FNK--------------PTGYGSSI--------RRAPQ-TGIVDECCFRSCDLRRLEM 145

  Fly   131 YCSVVR 136
            ||:.::
Mouse   146 YCAPLK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 9/20 (45%)
Igf1XP_006513318.1 IlGF 87..154 CDD:239834 26/113 (23%)

Return to query results.
Submit another query.