DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ilp2 and LOC100534937

DIOPT Version :9

Sequence 1:	NP_524012.1	Gene:	Ilp2 / 39150	FlyBaseID:	FBgn0036046	Length:	137	Species:	Drosophila melanogaster
Sequence 2:	XP_009297891.1	Gene:	LOC100534937 / 100534937	-ID:	-	Length:	112	Species:	Danio rerio

Alignment Length:	142	Identity:	34/142 - (23%)
Similarity:	49/142 - (34%)	Gaps:	58/142 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 LSFISMVAVILLASSTVKLAQGTLCSEKLNEVLSMVCEE----YNP----VIPHK-RAMPGADSD 60
            |..:|:.|..||..|... .:..||..:|.|.|.:||.|    :.|    |..|| |.:| ...:
Zfish     6 LLLLSLCAGSLLTHSGAG-GKRRLCGIQLVEALLIVCGEKGLFHQPWGKRVREHKLRKLP-CSGE 68

  Fly    61 LDALNPLQFVQEFEEEDNSISEPLRSALFPGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDM 125
            .||.                                             :::||||:||..|||
Zfish    69 RDAF---------------------------------------------EKRGIVEQCCHFSCD- 87

  Fly   126 KALREYCSVVRN 137
             .|..||:..::
Zfish    88 -DLENYCNTKKS 98

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ilp2	NP_524012.1	IlGF_insulin_bombyxin_like	<111..132	CDD:239832	10/20 (50%)
LOC100534937	XP_009297891.1	IlGF_insulin_like	26..94	CDD:239833	27/115 (23%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1644517at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010