DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and igf1

DIOPT Version :9

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_002936875.1 Gene:igf1 / 100486334 XenbaseID:XB-GENE-480239 Length:153 Species:Xenopus tropicalis


Alignment Length:134 Identity:33/134 - (24%)
Similarity:47/134 - (35%) Gaps:55/134 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSFISMVAVIL-LASSTVKLAQG--TLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDLDALNP 66
            :|:|.::.:.| ..:.|...|.|  |||..:|.:.|..||.:                       
 Frog    27 MSYIHLLYLALCFLTLTHSAAAGPETLCGAELVDTLQFVCGD----------------------- 68

  Fly    67 LQFVQEFEEEDNSISEPLRSALF--PGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALR 129
                              |...|  |..|  |..|      ||:..| |||:.||.:|||.:.|.
 Frog    69 ------------------RGFYFSKPTGY--GSSN------RRSHHR-GIVDECCFQSCDFRRLE 106

  Fly   130 EYCS 133
            .||:
 Frog   107 MYCA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 10/20 (50%)
igf1XP_002936875.1 IlGF 49..116 CDD:239834 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.