DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp2 and igf1

DIOPT Version :10

Sequence 1:NP_524012.1 Gene:Ilp2 / 39150 FlyBaseID:FBgn0036046 Length:137 Species:Drosophila melanogaster
Sequence 2:XP_002936875.1 Gene:igf1 / 100486334 XenbaseID:XB-GENE-480239 Length:153 Species:Xenopus tropicalis


Alignment Length:134 Identity:33/134 - (24%)
Similarity:47/134 - (35%) Gaps:55/134 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSFISMVAVIL-LASSTVKLAQG--TLCSEKLNEVLSMVCEEYNPVIPHKRAMPGADSDLDALNP 66
            :|:|.::.:.| ..:.|...|.|  |||..:|.:.|..||.:                       
 Frog    27 MSYIHLLYLALCFLTLTHSAAAGPETLCGAELVDTLQFVCGD----------------------- 68

  Fly    67 LQFVQEFEEEDNSISEPLRSALF--PGSYLGGVLNSLAEVRRRTRQRQGIVERCCKKSCDMKALR 129
                              |...|  |..|  |..|      ||:..| |||:.||.:|||.:.|.
 Frog    69 ------------------RGFYFSKPTGY--GSSN------RRSHHR-GIVDECCFQSCDFRRLE 106

  Fly   130 EYCS 133
            .||:
 Frog   107 MYCA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp2NP_524012.1 IlGF_insulin_bombyxin_like <111..132 CDD:239832 10/20 (50%)
igf1XP_002936875.1 IlGF 49..116 CDD:239834 28/112 (25%)

Return to query results.
Submit another query.