DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and igf3

DIOPT Version :9

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001108522.1 Gene:igf3 / 561569 ZFINID:ZDB-GENE-080611-1 Length:188 Species:Danio rerio


Alignment Length:152 Identity:27/152 - (17%)
Similarity:41/152 - (26%) Gaps:64/152 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 HGLRLQSL-----------LIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPHG 64
            |..|||.:           .:..:.:....::.|..:      .|....||..|.|.::.||   
Zfish     5 HAKRLQIMPGFMLKVPSWRSVCVLYSLCCVLILPDNT------EGARARCGRELVDDLEFVC--- 60

  Fly    65 FNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHL 129
                                      .|...:....||..|..|                  |..
Zfish    61 --------------------------GDRGFYIGKPGAARSGGP------------------RSR 81

  Fly   130 TGGVYDECCVKTCSYLELAIYC 151
            ..|:.|:|||:.|....|.:||
Zfish    82 GKGIVDQCCVRGCDLQHLELYC 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 7/19 (37%)
igf3NP_001108522.1 IlGF 43..110 CDD:239834 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.