DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and Ilp4

DIOPT Version :10

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_648361.1 Gene:Ilp4 / 39152 FlyBaseID:FBgn0044049 Length:134 Species:Drosophila melanogaster


Alignment Length:152 Identity:41/152 - (26%)
Similarity:64/152 - (42%) Gaps:42/152 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AMLTAAMAMVTPTGSGHQLLPP--GNHKLCGPALSDAMDVVCPHGFNTLPRK---------RESL 75
            :::...:|::....:..|||.|  |..|:||.||..|:||:|.:||....|:         |:.:
  Fly     2 SLIRLGLALLLLLATVSQLLQPVQGRRKMCGEALIQALDVICVNGFTRRVRRSSASKDARVRDLI 66

  Fly    76 LGNSDDDEDTEQEVQDDSSMWQTLD-----------GAGYSFSPLLTNLYGSEVLIKMRRHRRHL 129
            ......|||.|||.:......:..|           |:|.                |:|||||.:
  Fly    67 RKLQQPDEDIEQETETGRLKQKHTDADTEKGVPPAVGSGR----------------KLRRHRRRI 115

  Fly   130 TGGVYDECCVKTCSYLELAIYC 151
            .    .|||.:.|:|.::..||
  Fly   116 A----HECCKEGCTYDDILDYC 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 5/19 (26%)
Ilp4NP_648361.1 IlGF_like <115..133 CDD:470583 5/21 (24%)

Return to query results.
Submit another query.