DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and Ilp3

DIOPT Version :10

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster


Alignment Length:114 Identity:33/114 - (28%)
Similarity:50/114 - (43%) Gaps:34/114 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGA------GYS 105
            ||||..|.:.:..:|.:|||.:.::                          |||..      |:.
  Fly    32 KLCGRKLPETLSKLCVYGFNAMTKR--------------------------TLDPVNFNQIDGFE 70

  Fly   106 FSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYCLPK 154
            ...||..|. |:..::|.:.|| |..||:||||:|:|:..|:..||..|
  Fly    71 DRSLLERLL-SDSSVQMLKTRR-LRDGVFDECCLKSCTMDEVLRYCAAK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 9/19 (47%)
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 29/108 (27%)

Return to query results.
Submit another query.