DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and Ilp3

DIOPT Version :9

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_648360.2 Gene:Ilp3 / 39151 FlyBaseID:FBgn0044050 Length:120 Species:Drosophila melanogaster


Alignment Length:114 Identity:33/114 - (28%)
Similarity:50/114 - (43%) Gaps:34/114 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KLCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGA------GYS 105
            ||||..|.:.:..:|.:|||.:.::                          |||..      |:.
  Fly    32 KLCGRKLPETLSKLCVYGFNAMTKR--------------------------TLDPVNFNQIDGFE 70

  Fly   106 FSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYCLPK 154
            ...||..|. |:..::|.:.|| |..||:||||:|:|:..|:..||..|
  Fly    71 DRSLLERLL-SDSSVQMLKTRR-LRDGVFDECCLKSCTMDEVLRYCAAK 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 9/19 (47%)
Ilp3NP_648360.2 IlGF_insulin_bombyxin_like 33..114 CDD:239832 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYBW
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136481at33392
OrthoFinder 1 1.000 - - FOG0012718
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109163
Panther 1 1.100 - - P PTHR13647
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.