DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and IGF2

DIOPT Version :10

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001121070.1 Gene:IGF2 / 3481 HGNCID:5466 Length:236 Species:Homo sapiens


Alignment Length:146 Identity:28/146 - (19%)
Similarity:37/146 - (25%) Gaps:80/146 - (54%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AMVTPTGSGHQLLPPG----------------------NHKLCGPALSDAMDVVC-PHGFNTLPR 70
            ||.||.|     :|.|                      :..|||..|.|.:..|| ..||     
Human    52 AMQTPMG-----IPMGKSMLVLLTFLAFASCCIAAYRPSETLCGGELVDTLQFVCGDRGF----- 106

  Fly    71 KRESLLGNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYD 135
                                                       |.|....::.|..|    |:.:
Human   107 -------------------------------------------YFSRPASRVSRRSR----GIVE 124

  Fly   136 ECCVKTCSYLELAIYC 151
            |||.::|....|..||
Human   125 ECCFRSCDLALLETYC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 6/19 (32%)
IGF2NP_001121070.1 nt_trans <4..51 CDD:469580
IlGF 84..147 CDD:239834 21/109 (19%)
IGF2_C 168..222 CDD:462445
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.