DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ilp1 and igf2b

DIOPT Version :9

Sequence 1:	NP_648359.1	Gene:	Ilp1 / 39149	FlyBaseID:	FBgn0044051	Length:	154	Species:	Drosophila melanogaster
Sequence 2:	NP_001001815.1	Gene:	igf2b / 324215	ZFINID:	ZDB-GENE-030131-2935	Length:	212	Species:	Danio rerio

Alignment Length:	104	Identity:	23/104 - (22%)
Similarity:	30/104 - (28%)	Gaps:	48/104 - (46%)

- Green bases have known domain annotations that are detailed below.

  Fly    48 LCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSPLLTN 112
            |||..|.||:..||                     ||                 .|:.||...:.
Zfish    53 LCGGELVDALQFVC---------------------ED-----------------RGFYFSRPTSR 79

  Fly   113 LYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYC 151
                      ...||....|:.:|||..:|:...|..||
Zfish    80 ----------SNSRRSQNRGIVEECCFSSCNLALLEQYC 108

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ilp1	NP_648359.1	IlGF_insulin_bombyxin_like	<131..151	CDD:239832	6/19 (32%)
igf2b	NP_001001815.1	B domain	46..77		13/61 (21%)
		IlGF	49..115	CDD:239834	23/104 (22%)
		C domain	78..88		2/19 (11%)
		A domain	89..109		8/20 (40%)
		D domain	110..115
		E domain	116..212
		IGF2_C	144..199	CDD:285554
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1644517at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	2	1.920