DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and Ilp6

DIOPT Version :9

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001188538.1 Gene:Ilp6 / 31220 FlyBaseID:FBgn0044047 Length:107 Species:Drosophila melanogaster


Alignment Length:141 Identity:32/141 - (22%)
Similarity:44/141 - (31%) Gaps:53/141 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLIAAMLTAAMAMVT---PTGSGHQLLP---PGNHKLCGPALSDAMDVVCPHGFNTLPRKRESLL 76
            ||:.|.|.|..||::   |..:...|.|   .....:|...|||.:..:|..|...|        
  Fly    11 LLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCSTGLSDVIQKICVSGTVAL-------- 67

  Fly    77 GNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVK- 140
                                          ..:..|.:|       :|.:|.|. .|.|.||.. 
  Fly    68 ------------------------------GDVFPNSFG-------KRRKRDLQ-NVTDLCCKSG 94

  Fly   141 TCSYLELAIYC 151
            .|:|.||..||
  Fly    95 GCTYRELLQYC 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 8/20 (40%)
Ilp6NP_001188538.1 IlGF_like <78..105 CDD:295312 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D160688at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.