DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and igf2a

DIOPT Version :10

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_571508.1 Gene:igf2a / 30710 ZFINID:ZDB-GENE-991111-3 Length:197 Species:Danio rerio


Alignment Length:134 Identity:28/134 - (20%)
Similarity:39/134 - (29%) Gaps:61/134 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVC-PHGFNTLPRKRESLLGNSDDD 82
            ||..:|:.:|.:...|         ....|||..|.|.:..|| ..||                 
Zfish    24 LIVFVLSLSMLISNVT---------AGETLCGGELVDTLQFVCGEDGF----------------- 62

  Fly    83 EDTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLEL 147
                                 |...|..:|         .||.:|    |:.:|||.::|....|
Zfish    63 ---------------------YISRPNRSN---------SRRPQR----GIVEECCFRSCELHLL 93

  Fly   148 AIYC 151
            ..||
Zfish    94 QQYC 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 6/19 (32%)
igf2aNP_571508.1 IlGF 40..104 CDD:239834 23/109 (21%)
IGF2_C 129..184 CDD:462445
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.