DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and igf2a

DIOPT Version :9

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_571508.1 Gene:igf2a / 30710 ZFINID:ZDB-GENE-991111-3 Length:197 Species:Danio rerio


Alignment Length:134 Identity:28/134 - (20%)
Similarity:39/134 - (29%) Gaps:61/134 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVC-PHGFNTLPRKRESLLGNSDDD 82
            ||..:|:.:|.:...|         ....|||..|.|.:..|| ..||                 
Zfish    24 LIVFVLSLSMLISNVT---------AGETLCGGELVDTLQFVCGEDGF----------------- 62

  Fly    83 EDTEQEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLEL 147
                                 |...|..:|         .||.:|    |:.:|||.::|....|
Zfish    63 ---------------------YISRPNRSN---------SRRPQR----GIVEECCFRSCELHLL 93

  Fly   148 AIYC 151
            ..||
Zfish    94 QQYC 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 6/19 (32%)
igf2aNP_571508.1 IlGF 40..104 CDD:239834 23/109 (21%)
IGF2_C 129..184 CDD:285554
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109163
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.