DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and Igf1

DIOPT Version :10

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001075947.1 Gene:Igf1 / 24482 RGDID:2868 Length:159 Species:Rattus norvegicus


Alignment Length:128 Identity:33/128 - (25%)
Similarity:42/128 - (32%) Gaps:53/128 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVC-PHGFNTLPRKRESLLGNSDDDEDTEQEVQ 90
            |:.::|.|.|.    ..|...|||..|.||:..|| |.||                         
  Rat    36 ALCLLTFTSSA----TAGPETLCGAELVDALQFVCGPRGF------------------------- 71

  Fly    91 DDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYCLP 153
                         |...|   ..|||.:       ||....|:.||||.::|....|.:||.|
  Rat    72 -------------YFNKP---TGYGSSI-------RRAPQTGIVDECCFRSCDLRRLEMYCAP 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 7/19 (37%)
Igf1NP_001075947.1 IlGF 49..116 CDD:239834 29/111 (26%)
B 49..77 14/68 (21%)
C 78..89 5/17 (29%)
A 90..110 8/19 (42%)
D 111..118 1/1 (100%)

Return to query results.
Submit another query.