DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and ins-1

DIOPT Version :10

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_501926.1 Gene:ins-1 / 177936 WormBaseID:WBGene00002084 Length:109 Species:Caenorhabditis elegans


Alignment Length:130 Identity:27/130 - (20%)
Similarity:43/130 - (33%) Gaps:48/130 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 AAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVCPH----GFNTLPRKRESLLGNSDDDEDTE 86
            |.:.:.:||.|...:      :|||..|:..:..||.:    |.....|                
 Worm    18 AILLLSSPTPSDASI------RLCGSRLTTTLLAVCRNQLCTGLTAFKR---------------- 60

  Fly    87 QEVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYC 151
                          .|..|::|...:|:        ..|.:...||:..|||.|.||:..|..:|
 Worm    61 --------------SADQSYAPTTRDLF--------HIHHQQKRGGIATECCEKRCSFAYLKTFC 103

  Fly   152  151
             Worm   104  103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 9/19 (47%)
ins-1NP_501926.1 IlGF_insulin_bombyxin_like 34..103 CDD:239832 22/106 (21%)

Return to query results.
Submit another query.