DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Ilp1 and Ins1

DIOPT Version :9

Sequence 1:	NP_648359.1	Gene:	Ilp1 / 39149	FlyBaseID:	FBgn0044051	Length:	154	Species:	Drosophila melanogaster
Sequence 2:	NP_032412.3	Gene:	Ins1 / 16333	MGIID:	96572	Length:	108	Species:	Mus musculus

Alignment Length:	144	Identity:	38/144 - (26%)
Similarity:	53/144 - (36%)	Gaps:	43/144 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly    10 VHGLRLQSLLIAAMLTAAMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVC-PHGFNTLPRKRE 73
            ||.|.|.:||.........|.|             ...||||.|.:|:.:|| ..||...|:.|.
Mouse     5 VHFLPLLALLALWEPKPTQAFV-------------KQHLCGPHLVEALYLVCGERGFFYTPKSRR 56

  Fly    74 SLLGNSDDDEDTEQ-EVQDDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDEC 137
            .:     :|...|| |:.......|||                   .:::.|.:|    |:.|:|
Mouse    57 EV-----EDPQVEQLELGGSPGDLQTL-------------------ALEVARQKR----GIVDQC 93

  Fly   138 CVKTCSYLELAIYC 151
            |...||..:|..||
Mouse    94 CTSICSLYQLENYC 107

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Ilp1	NP_648359.1	IlGF_insulin_bombyxin_like	<131..151	CDD:239832	7/19 (37%)
Ins1	NP_032412.3	IlGF_insulin_like	26..108	CDD:239833	31/123 (25%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1644517at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920