powered by:
Protein Alignment Ilp1 and Igf1
DIOPT Version :9
Sequence 1: | NP_648359.1 |
Gene: | Ilp1 / 39149 |
FlyBaseID: | FBgn0044051 |
Length: | 154 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006513318.1 |
Gene: | Igf1 / 16000 |
MGIID: | 96432 |
Length: | 197 |
Species: | Mus musculus |
Alignment Length: | 128 |
Identity: | 33/128 - (25%) |
Similarity: | 42/128 - (32%) |
Gaps: | 53/128 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 AMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVC-PHGFNTLPRKRESLLGNSDDDEDTEQEVQ 90
|:.::|.|.| ...|...|||..|.||:..|| |.||
Mouse 74 ALCLLTFTSS----TTAGPETLCGAELVDALQFVCGPRGF------------------------- 109
Fly 91 DDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYCLP 153
|...| ..|||.: ||....|:.||||.::|....|.:||.|
Mouse 110 -------------YFNKP---TGYGSSI-------RRAPQTGIVDECCFRSCDLRRLEMYCAP 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1644517at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.