DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and igf2

DIOPT Version :9

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_012816008.1 Gene:igf2 / 100134992 XenbaseID:XB-GENE-482586 Length:217 Species:Xenopus tropicalis


Alignment Length:104 Identity:20/104 - (19%)
Similarity:26/104 - (25%) Gaps:50/104 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LCGPALSDAMDVVCPHGFNTLPRKRESLLGNSDDDEDTEQEVQDDSSMWQTLDGAGYSFSPLLTN 112
            |||..|.|.:..||                                      ...|:.||.    
 Frog    63 LCGGELVDTLQFVC--------------------------------------GDRGFYFSR---- 85

  Fly   113 LYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYC 151
                    ...|..|....|:.:|||.::|....|..||
 Frog    86 --------NNGRSNRRANRGIVEECCFRSCDLELLETYC 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 6/19 (32%)
igf2XP_012816008.1 IlGF 59..123 CDD:239834 20/104 (19%)
IGF2_C 150..205 CDD:369833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1644517at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.