DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and PDLIM1

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_066272.1 Gene:PDLIM1 / 9124 HGNCID:2067 Length:329 Species:Homo sapiens


Alignment Length:276 Identity:75/276 - (27%)
Similarity:115/276 - (41%) Gaps:52/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
            |||||||||.|::.||.:.:||.||.|..|.|.:.|:|..|:....:.:||.||...|.|.....
Human    13 PWGFRLVGGKDFEQPLAISRVTPGSKAALANLCIGDVITAIDGENTSNMTHLEAQNRIKGCTDNL 77

  Fly    79 YFGVYRENEEDAYECL-----KKFP-----TSE-------GSL-TKSPMP-TISPSPTPSLSQLT 124
            ...|.| :|...:..|     |:.|     .||       ||. .:|.|| |.||:.:.:...:|
Human    78 TLTVAR-SEHKVWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAHNRSAMPFTASPASSTTARVIT 141

  Fly   125 ETTN--ARTPEPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEE--------KRGD 179
            ...|  |.....|........|.:.| ||..||.:...|...:.|.|.|..:|        ::.:
Human   142 NQYNNPAGLYSSENISNFNNALESKT-AASGVEANSRPLDHAQPPSSLVIDKESEVYKMLQEKQE 205

  Fly   180 VNGHDAPGQADEGGLPVENLYLPDL--------PDRPCSALSERQEIKLVEEEIAAVLSGESEVL 236
            :|  :.|.|:      ...|.|.::        |::|    |..:.:|....::||.: |.::.|
Human   206 LN--EPPKQS------TSFLVLQEILESEEKGDPNKP----SGFRSVKAPVTKVAASI-GNAQKL 257

  Fly   237 KEHNVLGVNFYRIFPK 252
            ...:..|.....:|.|
Human   258 PMCDKCGTGIVGVFVK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 28/60 (47%)
DUF4749 653..>699 CDD:292558
PDLIM1NP_066272.1 PDZ_signaling 10..82 CDD:238492 28/68 (41%)
DUF4749 138..230 CDD:318205 20/100 (20%)
LIM_CLP36 260..311 CDD:188832 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10447
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.