DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Pdzk1

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_113900.1 Gene:Pdzk1 / 65144 RGDID:70924 Length:523 Species:Rattus norvegicus


Alignment Length:231 Identity:56/231 - (24%)
Similarity:91/231 - (39%) Gaps:39/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVFY 79
            :||.|..|.:....: :..:..||.|:.|||:..|::|.:|..:...|.||....:|...|....
  Rat   253 YGFYLRAGPEQKGQI-IKDIEPGSPAEAAGLKNNDLVVAVNGESVEALDHDSVVEMIRNGGDQTT 316

  Fly    80 FGVYRENEEDAYECLKKF---------PTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPE 135
            ..|. :.|.|....|.:|         ....||:.::|.|..:|...|. |..||......|:  
  Rat   317 LLVL-DKEADRIYSLARFSPLLYCQSQELPNGSVKEAPAPISAPLEAPG-SATTEDVGDHKPK-- 377

  Fly   136 PFVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDVNGHDAPGQADEGGLPVENLY 200
             ...|.:|..:......|:.         .||.|.| .|.::|        |.||:.||..|::.
  Rat   378 -LCRLIKEDDSYGFHLNAIR---------GQPGSFV-KEVQQG--------GPADKAGLENEDII 423

  Fly   201 L----PDLPDRPCSALSERQEIKLVEEEIAAVLSGE 232
            :    .::.|.|...:.||  ||...|.:..::.|:
  Rat   424 IEVNGENVQDEPYDRVVER--IKSSGEHVTLLVCGK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 17/59 (29%)
DUF4749 653..>699 CDD:292558
Pdzk1NP_113900.1 PDZ_signaling 7..87 CDD:238492
PDZ 132..212 CDD:214570
PDZ_signaling 242..320 CDD:238492 18/67 (27%)
PDZ 375..455 CDD:214570 23/102 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 479..523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.