DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and PDLIM2

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_067643.3 Gene:PDLIM2 / 64236 HGNCID:13992 Length:602 Species:Homo sapiens


Alignment Length:362 Identity:95/362 - (26%)
Similarity:133/362 - (36%) Gaps:126/362 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
            |||||:.||.|:..|:.|.||.|...|.:|.||..||||.||..:|..:.|.||...|..|.|..
Human   262 PWGFRITGGRDFHTPIMVTKVAERGKAKDADLRPGDIIVAINGESAEGMLHAEAQSKIRQSPSPL 326

  Fly    79 YFGVYRE--------NEEDAYECL--------KKFPTSEGSLTKS-PMPT-ISP------SPTPS 119
            ...:.|.        |.:.:.|.|        :.:..|:.||..| ..|| :||      ||.||
Human   327 RLQLDRSQATSPGQTNGDSSLEVLATRFQGSVRTYTESQSSLRSSYSSPTSLSPRAGSPFSPPPS 391

  Fly   120 LSQLT-ETTNARTPEPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDVNGH 183
            .|.|| |...:|:     |..|     |.:...||    .|.|:...:|.|.            .
Human   392 SSSLTGEAAISRS-----FQSL-----ACSPGLPA----ADRLSYSGRPGSR------------Q 430

  Fly   184 DAPGQADEGGLPVENLYLPDLP----DRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGV 244
            ...|:|.:..:    |.||..|    .||          .:..|..:.:|..:|||.|       
Human   431 AGLGRAGDSAV----LVLPPSPGPRSSRP----------SMDSEGGSLLLDEDSEVFK------- 474

  Fly   245 NFYRIFPKPGVCMSSDVLRSLNEEVTKTKLEKDKEN----RQWSTF--LQRPNRPVPKSKQSLEA 303
                                        .|::::|.    ||.|:|  ||          ::|||
Human   475 ----------------------------MLQENREGRAAPRQSSSFRLLQ----------EALEA 501

  Fly   304 ERRAANAYKVTIVKSAPREKSPMPEAKPAPKEATPPK 340
            |.|....   ..:.|:...:|.:|.::..   |||||
Human   502 EERGGTP---AFLPSSLSPQSSLPASRAL---ATPPK 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 28/60 (47%)
DUF4749 653..>699 CDD:292558
PDLIM2NP_067643.3 PDZ_signaling 259..330 CDD:238492 30/67 (45%)
DUF4749 <462..505 CDD:292558 17/87 (20%)
LIM_Mystique 536..588 CDD:188833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8352
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41321
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.