DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and pdlim7

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001025639.1 Gene:pdlim7 / 595027 XenbaseID:XB-GENE-5860425 Length:191 Species:Xenopus tropicalis


Alignment Length:188 Identity:50/188 - (26%)
Similarity:80/188 - (42%) Gaps:32/188 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSG--- 75
            ||||||.||.|::.||::.::|.|..|:.||:.|.|.:::|...:.|.:||.||...|..|.   
 Frog    13 PWGFRLQGGKDFNMPLSISRLTPGGKAELAGVNVGDWLLQIEGDSTTSMTHIEAQNKIRASSNKL 77

  Fly    76 ----SVFYFGVYRENEEDAYECLKKFPTSEG---------SLTKSPMPTISPSPTPSLSQLTETT 127
                |.|..||   |:......    |.|:|         :|.|...|..:.:|.|..|:..:.|
 Frog    78 GLVLSRFAVGV---NQAKGVHT----PESQGRKYNFAPSTALNKIARPFGTGTPPPDNSRPGQLT 135

  Fly   128 NARTPEPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQP----MSEVHSEEKRGDVN 181
                 :|..:.|.|.....:..|...::.....:.|.:.|    :.:.|.|.....:|
 Frog   136 -----KPVAYNPPPTSYTTSQTAQGQLQNGEKFITELQSPRYTRLRDWHHERSACSLN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 25/60 (42%)
DUF4749 653..>699 CDD:292558
pdlim7NP_001025639.1 PDZ_signaling 3..81 CDD:238492 26/67 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5637
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.