DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and GOPC

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_065132.1 Gene:GOPC / 57120 HGNCID:17643 Length:462 Species:Homo sapiens


Alignment Length:225 Identity:58/225 - (25%)
Similarity:85/225 - (37%) Gaps:68/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 VPVKSE------EELALERQLADVQRQLAALSSLPSTIQSTLDAVTKQLADLLPTIK-------L 486
            |.:|||      |::.||:::.|   ||..|.|    ||..|.|.|.|.|| ..|||       :
Human    99 VDLKSELTETQAEKVVLEKEVHD---QLLQLHS----IQLQLHAKTGQSAD-SGTIKAKLSGPSV 155

  Fly   487 QQQEKQLPQIDENSGNEEQVEEGVTTATNTINTAGETEDAGKDISISGSDNPPVGPCESNEDRCD 551
            ::.|::|....:....|.|:|                    .::.:...:|             :
Human   156 EELERELEANKKEKMKEAQLE--------------------AEVKLLRKEN-------------E 187

  Fly   552 ANDREVAEISRSTDDNRLAKDKKKDLDQEQKQQQQQQQEPLSEEQNFKKQKRHDVI---EELEEH 613
            |..|.:|.:.......|||   .|.||:|...:.||.| .|..:.   |...||.:   .|.|.|
Human   188 ALRRHIAVLQAEVYGARLA---AKYLDKELAGRVQQIQ-LLGRDM---KGPAHDKLWNQLEAEIH 245

  Fly   614 LVRKNNPRRSKRAFGPLVPSSERPLVLPGG 643
            |.|.....|:.|....|    :||:..|.|
Human   246 LHRHKTVIRACRGRNDL----KRPMQAPPG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558
GOPCNP_065132.1 bZIP_2 <166..199 CDD:285017 7/65 (11%)
PDZ_signaling 286..368 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.