DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and lnx2b

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_998105.2 Gene:lnx2b / 564464 ZFINID:ZDB-GENE-040426-2500 Length:678 Species:Danio rerio


Alignment Length:396 Identity:78/396 - (19%)
Similarity:120/396 - (30%) Gaps:145/396 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   436 PVKSEEELALERQLADVQRQLAALSSLPSTIQSTLDAVTKQLADLLPTIKLQQQE---KQLPQID 497
            |.:||.||:::|  .::|                     ..|.:..|..|..::|   |:.|..:
Zfish   111 PFRSECELSMQR--CELQ---------------------PHLHNRCPAFKRLREEAERKKRPSWN 152

  Fly   498 ENSGNEEQVEEGVTTATNTINTAGET--------------------------------------- 523
            |..|::   .:|......:..|.|.|                                       
Zfish   153 ELKGSK---SDGDLADAKSAQTIGRTAQLSAPSEPGLVNPAFEEGEDDTPLRCSLVAEATVVELF 214

  Fly   524 -EDAGKDIS---ISGSDNP----------------PVGPCESNEDRCDANDREVAEISRS----- 563
             ||.|:|:.   :.|.|.|                ..|.....:...:.||..:|.||.|     
Zfish   215 REDPGEDLGLRIVGGKDTPLGNIVIQEIVRDSLVARDGKLAPGDHILEVNDVSLASISHSRAIAV 279

  Fly   564 ----TDDNRLAKDKKKDLDQEQKQQQQQQQEPLSEEQNFKKQKRHDVIE-ELEEHLVRKNNPRRS 623
                ....||...::|......:...|....|.::..: ..|....||: .|.:|       .||
Zfish   280 IRQPCSRLRLTVMQEKGFKPRPEHHTQPSASPPTQSPS-TNQNHGTVIQVTLVKH-------ERS 336

  Fly   624 KRAFGPLVPSSERPLV-----LPGGRRWYRPKDAYNDEFIA--------ETLSAQAELITGSTLG 675
            :.....|:..||.|.|     ||||......|...||:.:.        .|..:.|::|..|.:.
Zfish   337 EALGIKLIRKSEEPGVFILDLLPGGLAAKDGKLRNNDKVLGINGQDLRHGTPESAAQIIQASEMR 401

  Fly   676 VNF--MKYQK----------------PERKIDLNRSEVYKYLNPHLDRAPVRGIEVRAPLVAAES 722
            |||  |:.|.                ||.:.....||..|        .|..|...:...|..:.
Zfish   402 VNFVVMRLQDVSEEGGEGQSRGARRVPEPQYFRRHSEYMK--------EPPGGFSSQEKTVTLKK 458

  Fly   723 DIRQSL 728
            :.||||
Zfish   459 EPRQSL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558 16/71 (23%)
lnx2bNP_998105.2 RING 46..82 CDD:214546
PDZ_signaling 210..291 CDD:238492 16/80 (20%)
PDZ_signaling 325..406 CDD:238492 25/87 (29%)
PDZ_signaling 451..537 CDD:238492 5/14 (36%)
PDZ_signaling 587..671 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.