DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and pdlim3b

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_005157291.1 Gene:pdlim3b / 561865 ZFINID:ZDB-GENE-060130-104 Length:332 Species:Danio rerio


Alignment Length:345 Identity:74/345 - (21%)
Similarity:117/345 - (33%) Gaps:106/345 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGS---- 74
            ||||||.||.|::.|||:.:||.||.|....|...|||:.|...:...:||.||...|..|    
Zfish    12 PWGFRLSGGKDFNQPLTITRVTPGSKASRVNLCPGDIILSIQGVSTDGMTHAEAQNNIKDSTNQL 76

  Fly    75 -------------------GSVFYFGVYRENEE---DAYECLKKFPTSEGSLTKSPMPTISPSPT 117
                               |.|..|.:..|.|:   |.:|  .||             .:.|.|.
Zfish    77 FLKIERPETKIWSPQVIEEGKVNPFKINLEAEKQDIDYFE--HKF-------------NVRPKPF 126

  Fly   118 PSLSQLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDVNG 182
            .|.||.:::|:      :..:....::|.....|.:|:.:..|.......:|....:.:...|..
Zfish   127 TSASQRSDSTS------QTLMGNVAQMAGTPSTAHSVQYNSPVALYSADNVSNTLQQAQMSTVVR 185

  Fly   183 HDAPGQADEGGLPVENLY--LPDLPDRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVN 245
            ..:|.......:...::|  |.|..::|   ...||             ||..:.|:::      
Zfish   186 QASPSSKPLTSIEDSHVYRMLQDANEQP---HEPRQ-------------SGSFKALQDY------ 228

  Fly   246 FYRIFPKPGVCMSSD-----VLRSLNEEVTKTKLEKDKENRQWSTFLQRPNRPVPKSKQSLEAER 305
                       :.||     |.||:...|||.                   :....|.|.|....
Zfish   229 -----------VESDGTRPMVTRSVKAPVTKP-------------------QAATSSLQKLPLCD 263

  Fly   306 RAANAYKVTIVKSAPREKSP 325
            :.......|:||:..:.:.|
Zfish   264 KCGTGIVGTVVKARDKYRHP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 28/83 (34%)
DUF4749 653..>699 CDD:292558
pdlim3bXP_005157291.1 PDZ_signaling 2..81 CDD:238492 28/68 (41%)
DUF4749 156..232 CDD:292558 14/108 (13%)
LIM_ALP 262..314 CDD:188834 4/22 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.