DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and lnx1

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_005160562.1 Gene:lnx1 / 561226 ZFINID:ZDB-GENE-030131-9439 Length:769 Species:Danio rerio


Alignment Length:368 Identity:68/368 - (18%)
Similarity:114/368 - (30%) Gaps:144/368 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GFRLVGGADYDYPLTVVKVTEGSIADEAG-LRVEDIIVRINDTAATPLTHD-------EAHRLIM 72
            |.:||...| ::.:.:..:.||.:|...| |||:|.::.||.       ||       .|..||.
Zfish   425 GIKLVRRPD-EHGVFIFHLLEGGLAARDGRLRVDDRVLAING-------HDLRYGAPEHAALLIQ 481

  Fly    73 GSGSVFYFGVYRENEEDAYECLKKFP-TSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEP 136
            .|....:|.|.|:....|.:.|::.| ..||                               |.|
Zfish   482 ASEDRVHFIVSRQTHIPAPDILQEAPWNMEG-------------------------------PPP 515

  Fly   137 FVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDV--NGHDAPGQADEGGLPVENL 199
            :.|              |:::..:|..|::|.    ..||...:  ..||:.|....||:.....
Zfish   516 YSP--------------VDIEHTLLDSCQKPA----CYEKTVTLLKEPHDSLGMTVAGGMSSRGW 562

  Fly   200 YLPDLPDRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVNFYRIFPKPGVCMSSDVLRS 264
            .||               :.:...:...|:..|..:.|...:|.||        ||.::.     
Zfish   563 DLP---------------VYVTNVDPNGVVGQEGSIRKGDILLNVN--------GVDLTG----- 599

  Fly   265 LNEEVTKTKLEKDKENRQWSTFLQRPNRPVPKSKQSLEAERRAANAYKVTIVKSAPREKSPM--- 326
                ||:::...:.:|......||                          :::..|..:|.:   
Zfish   600 ----VTRSEAVANLKNTSSPVVLQ--------------------------VLEMRPPNESSLDCM 634

  Fly   327 -PEAKPAPKEATPPKEVEKKEEEPVPEEVVEPEPEPEKDEEPL 368
             |...|.....:.|.:|:.              |.|..|..||
Zfish   635 PPLHSPCALSPSSPGDVKL--------------PPPNDDYAPL 663

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 19/66 (29%)
DUF4749 653..>699 CDD:292558
lnx1XP_005160562.1 RING 57..93 CDD:214546
PDZ_signaling 297..381 CDD:238492
PDZ_signaling 411..491 CDD:238492 21/73 (29%)
PDZ_signaling 536..621 CDD:238492 22/142 (15%)
DegQ <548..621 CDD:223343 18/130 (14%)
PDZ_signaling 678..762 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.