powered by:
Protein Alignment Zasp67 and pdzd3a
DIOPT Version :9
Sequence 1: | NP_648358.2 |
Gene: | Zasp67 / 39148 |
FlyBaseID: | FBgn0036044 |
Length: | 730 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_685398.3 |
Gene: | pdzd3a / 557269 |
ZFINID: | ZDB-GENE-080430-1 |
Length: | 520 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 33/72 - (45%) |
Gaps: | 1/72 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KMCRFDNVPWGFRLVGGADYDYPLTVV-KVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHR 69
::|.......||....|...:.|.|.: :|..||..:.||||..|:::.:|.........||..|
Zfish 410 RLCELHKEGTGFGFNLGCVENKPGTYIGQVVSGSTGERAGLRKWDVLIEVNGQNVEDEYFDEVVR 474
Fly 70 LIMGSGS 76
||.|.|:
Zfish 475 LITGGGT 481
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.