DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and LIMS2

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_060450.2 Gene:LIMS2 / 55679 HGNCID:16084 Length:365 Species:Homo sapiens


Alignment Length:165 Identity:36/165 - (21%)
Similarity:61/165 - (36%) Gaps:54/165 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 DEGGLPVENLYLPDLPDRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVNFYRIFPKPG 254
            |:.|:|:.......:..|..:||.::..   ||..:.|..        |...||   :|.:.|.|
Human   215 DKMGVPICGACRRPIEGRVVNALGKQWH---VEHFVCAKC--------EKPFLG---HRHYEKKG 265

  Fly   255 --------------VC------MSSDVLRSLNE---------EVTKTKLE-KDKENRQWSTFLQR 289
                          ||      :..||:.:||:         ....:||. |:|       |::.
Human   266 LAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVSCFSCSTCNSKLTLKNK-------FVEF 323

  Fly   290 PNRPVPK---SKQSLEAERRAANAYKVTIVKSAPR 321
            ..:||.|   .|..||.::|.....::|..|:.|:
Human   324 DMKPVCKRCYEKFPLELKKRLKKLSELTSRKAQPK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558
LIMS2NP_060450.2 LIM1_PINCH 39..97 CDD:188717
LIM2_PINCH 100..151 CDD:188718
LIM3_PINCH 164..214 CDD:188719
LIM4_PINCH 220..273 CDD:188720 13/66 (20%)
LIM5_PINCH 281..334 CDD:188721 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154977
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.