powered by:
Protein Alignment Zasp67 and lims1
DIOPT Version :9
Sequence 1: | NP_648358.2 |
Gene: | Zasp67 / 39148 |
FlyBaseID: | FBgn0036044 |
Length: | 730 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021335295.1 |
Gene: | lims1 / 554019 |
ZFINID: | ZDB-GENE-050522-236 |
Length: | 345 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 26/71 - (36%) |
Gaps: | 29/71 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 601 QKRHDVIEELEEHLVRKNNPRRSKRAFGPLVPSSERPLVLPGGRRWYRPKDAYNDEFIAETLSAQ 665
||.|.:|| |:.|:.||:| |.| |.:|.....:.|:|.
Zfish 147 QKCHAIIE--EQPLIFKNDP--------------------------YHP-DHFNCSNCGKELTAD 182
Fly 666 AELITG 671
|..:.|
Zfish 183 ARELKG 188
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170590006 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.