DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and lims1

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_021335295.1 Gene:lims1 / 554019 ZFINID:ZDB-GENE-050522-236 Length:345 Species:Danio rerio


Alignment Length:71 Identity:18/71 - (25%)
Similarity:26/71 - (36%) Gaps:29/71 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 QKRHDVIEELEEHLVRKNNPRRSKRAFGPLVPSSERPLVLPGGRRWYRPKDAYNDEFIAETLSAQ 665
            ||.|.:||  |:.|:.||:|                          |.| |.:|.....:.|:|.
Zfish   147 QKCHAIIE--EQPLIFKNDP--------------------------YHP-DHFNCSNCGKELTAD 182

  Fly   666 AELITG 671
            |..:.|
Zfish   183 ARELKG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558 5/19 (26%)
lims1XP_021335295.1 LIM1_PINCH 21..79 CDD:188717
LIM2_PINCH 82..133 CDD:188718
LIM3_PINCH 146..196 CDD:188719 18/71 (25%)
LIM4_PINCH 202..255 CDD:188720
LIM5_PINCH 263..316 CDD:188721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.