DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and lnx2a

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001106696.2 Gene:lnx2a / 553331 ZFINID:ZDB-GENE-060228-2 Length:737 Species:Danio rerio


Alignment Length:399 Identity:83/399 - (20%)
Similarity:127/399 - (31%) Gaps:133/399 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GFRLVGGADYDYPLTVVKVTE----GSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGS 76
            |..:|||  .:.||..|.:.|    |.||.:..|...|.|:::|:...:.:.|:.|...:....:
Zfish   283 GISIVGG--NETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNVPHNFARSTLARPCA 345

  Fly    77 VFYFGVYRENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLT----ETTN-------AR 130
            .....|.||....|               :.|..|.||..:|:..::|    |::.       .|
Zfish   346 TLQLTVLRERRCSA---------------RPPAATASPKGSPASIRITLHKRESSEQLGIKLVRR 395

  Fly   131 TPEPEPFV---------------------------------PLPRELAAATMAAPAVEVDVDVLA 162
            |.|...|:                                 |   ||||..:.|....|::.:..
Zfish   396 TDEAGVFILDLLEGGLAAKDGRLCSNDRVLAVNEHDLRHGTP---ELAAQIIQASGERVNLLISR 457

  Fly   163 ECRQPMSEVHSEEKRGDVNGHD----APGQADEGGLPVENLYLPDLPDRPCSALSERQEIKLVEE 223
            ..:|.|:.........|:..||    .|..|...  ||.:|:|.    |..:.....|.:...|:
Zfish   458 SSKQTMAVHTGSTLTRDIWSHDHIPPLPSTATPS--PVPSLHLA----RSSTQRDLSQCVNCKEK 516

  Fly   224 EIAAVLSGESEVLKE-HNVLGVN-------------FYRIFPKPGVCMS-------SDVLRSLNE 267
            .|.        |.|| |..||:.             .:....:|..|:|       .|||.|:  
Zfish   517 HIT--------VKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSI-- 571

  Fly   268 EVTKTKLEKDKENRQWSTFLQRPNRPVPKSKQSLEAERRAANAYKVTIVKSAPREKSPMPEAKPA 332
                        |.|..|:|.. :..|...|.|..:......|.:||:|           |....
Zfish   572 ------------NGQDLTYLSH-SEAVGTLKSSATSCSVQLKALEVTMV-----------EEPGL 612

  Fly   333 PKEATPPKE 341
            .:|..||.|
Zfish   613 DEELLPPHE 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 17/62 (27%)
DUF4749 653..>699 CDD:292558
lnx2aNP_001106696.2 zf-RING_2 49..87 CDD:290367
PDZ 267..353 CDD:214570 18/71 (25%)
PDZ_signaling 375..455 CDD:238492 13/82 (16%)
PDZ_signaling 515..600 CDD:238492 22/107 (21%)
PDZ_signaling 646..730 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.