DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and SYNJ2BP

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_060843.2 Gene:SYNJ2BP / 55333 HGNCID:18955 Length:145 Species:Homo sapiens


Alignment Length:88 Identity:23/88 - (26%)
Similarity:37/88 - (42%) Gaps:22/88 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GFRLVGGADYDY-----PLTVVKVTE-GSIADEAGLRVEDIIVRINDTAATPLTHDEA------- 67
            ||.:|||.|..|     .:.|.::.| |:.|.:..|:..|.|:.:|......|.|.:|       
Human    24 GFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNA 88

  Fly    68 ---------HRLIMGSGSVFYFG 81
                     |||.:.:|.:.:.|
Human    89 GYAVSLRVQHRLQVQNGPIGHRG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 21/80 (26%)
DUF4749 653..>699 CDD:292558
SYNJ2BPNP_060843.2 PDZ_signaling 13..97 CDD:238492 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.