Sequence 1: | NP_648358.2 | Gene: | Zasp67 / 39148 | FlyBaseID: | FBgn0036044 | Length: | 730 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017870.1 | Gene: | pdlim1 / 550568 | ZFINID: | ZDB-GENE-030131-5227 | Length: | 322 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 55/199 - (27%) |
---|---|---|---|
Similarity: | 82/199 - (41%) | Gaps: | 48/199 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
Fly 79 YFGVYR------------ENEEDAYEC-LKKFPTSE----GSL-TKSPMPTISPSPTPSLS---- 121
Fly 122 --------------------QLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQ 166
Fly 167 PMSE 170 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp67 | NP_648358.2 | PDZ_signaling | 2..75 | CDD:238492 | 28/60 (47%) |
DUF4749 | 653..>699 | CDD:292558 | |||
pdlim1 | NP_001017870.1 | PDZ_signaling | 2..80 | CDD:238492 | 29/67 (43%) |
DUF4749 | 133..223 | CDD:292558 | 12/78 (15%) | ||
LIM_CLP36 | 253..304 | CDD:188832 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24214 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |