DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and pdlim1

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001017870.1 Gene:pdlim1 / 550568 ZFINID:ZDB-GENE-030131-5227 Length:322 Species:Danio rerio


Alignment Length:199 Identity:55/199 - (27%)
Similarity:82/199 - (41%) Gaps:48/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
            |||||||||.|::.|||:.:||.||.|.:|.|.:.|:|:.|:..:...:||.||...|...|...
Zfish    12 PWGFRLVGGKDFEQPLTISRVTPGSKAAQADLCMGDMILAIDGESTDGMTHLEAQNKIKACGDEM 76

  Fly    79 YFGVYR------------ENEEDAYEC-LKKFPTSE----GSL-TKSPMPTISPSPTPSLS---- 121
            ...:.|            :.:.:.|:. |.|..|.|    ||. .:|.||..|.||....:    
Zfish    77 ALSIDRSESKMWSPLVTEDGKTNPYKMNLAKTNTQEEKHIGSAHNRSAMPFNSASPRVVTNQYNN 141

  Fly   122 --------------------QLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQ 166
                                |.|.|::..:...:|..|      ..|.||.|.:.:|..:.:..|
Zfish   142 PAGLYSSENIKNFNSAVDEVQTTATSSEASRNSDPSKP------GHTKAAIAADSEVYKMLQENQ 200

  Fly   167 PMSE 170
            ..:|
Zfish   201 ESNE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 28/60 (47%)
DUF4749 653..>699 CDD:292558
pdlim1NP_001017870.1 PDZ_signaling 2..80 CDD:238492 29/67 (43%)
DUF4749 133..223 CDD:292558 12/78 (15%)
LIM_CLP36 253..304 CDD:188832
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.