DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and PDZK1

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_024303384.1 Gene:PDZK1 / 5174 HGNCID:8821 Length:539 Species:Homo sapiens


Alignment Length:183 Identity:46/183 - (25%)
Similarity:72/183 - (39%) Gaps:35/183 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVFY 79
            :||.|..|::....: :..:..||.|:||||:..|::|.:|..:...|.||....:|...|....
Human   273 YGFYLRAGSEQKGQI-IKDIDSGSPAEEAGLKNNDLVVAVNGESVETLDHDSVVEMIRKGGDQTS 336

  Fly    80 FGVYRENEEDAYECLKKFP--------TSEGSLTKSPMPT------ISPSPT-------PSLSQL 123
            ..|..:..::.|......|        ...||:.::|.||      .||..|       |.|.:|
Human   337 LLVVDKETDNMYRLAHFSPFLYYQSQELPNGSVKEAPAPTPTSLEVSSPPDTTEEVDHKPKLCRL 401

  Fly   124 TE-------TTNARTPEPEPFVPL-----PRELAAATMAAPAVEVD-VDVLAE 163
            .:       ..||....|..|:..     |.:||........:||: |:||.|
Human   402 AKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDEDVIIEVNGVNVLDE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 18/59 (31%)
DUF4749 653..>699 CDD:292558
PDZK1XP_024303384.1 PDZ_signaling 27..107 CDD:238492
PDZ 152..232 CDD:214570
PDZ_signaling 261..340 CDD:238492 19/67 (28%)
PDZ 395..475 CDD:214570 16/60 (27%)
F1-ATPase_gamma <457..>501 CDD:320933
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.