DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Pdzd3

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001178925.1 Gene:Pdzd3 / 500986 RGDID:1559807 Length:498 Species:Rattus norvegicus


Alignment Length:498 Identity:94/498 - (18%)
Similarity:154/498 - (30%) Gaps:170/498 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WGFRL---VGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGS 76
            :||.|   :|.||:    .|.:|..||.|...|||..|.|:.:|:.......:....|.|..||.
  Rat    60 FGFHLQQQLGKADH----VVCRVDPGSSAQRQGLREGDRILAVNNNIVEHEDYAVVVRYIRASGP 120

  Fly    77 VFYFGVYRENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTE---------TTNARTP 132
            .....|..::   .|:..:....:|.    .|.||::....|.|..:.:         |..||.|
  Rat   121 RVLLTVLAQH---VYDVTRAQQGNEA----FPCPTLASGVRPRLCHVVKDEGGFGFSVTHGARGP 178

  Fly   133 EPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEEK---RGD-----VNGHDAPGQA 189
            .   ::.|....||.....|.....::|...|.:..:......|   .||     |.|.:...|.
  Rat   179 F---WLVLSAGGAAERAGVPPGARLLEVNGICVEKFTYNQLNRKLCQSGDRVTLLVAGPEVEEQC 240

  Fly   190 DEGGLPV-----ENLYLPDLPDRPCSALSERQEIKLVEEEIAAVLSGESEVLKEH----NVLGVN 245
            .:.|:|:     |...||..|  .|..:.:..:             |...:|:|.    ..||..
  Rat   241 HQLGMPLAAPLAEGWALPAKP--RCLNIEKGPQ-------------GFGFLLREEKGPDGRLGQF 290

  Fly   246 FYRIFP---------KPG---VCMSSDVLRSLNEEVTKTKLEKDKENRQWSTFLQRPNRPVPKSK 298
            .:.:.|         |.|   |.::.:.:..|..|.|.:::.  .:....|..:..|        
  Rat   291 LWEVDPGLPADKAGMKAGDRLVAVAGESMDGLGHEETVSRIR--AQGSCVSLVVVDP-------- 345

  Fly   299 QSLEAER--RAANAYKVTIVKSAPREKSPMPEAKPAPKEATPPKEVEKKEEEPVPEEVVEPE--- 358
               ||:|  .......:..:::.....:|:.|.|..|.|.|                 |||.   
  Rat   346 ---EADRFFSMVRLSPLLFLENTEIAAAPLAETKDLPVEDT-----------------VEPSGLA 390

  Fly   359 --------PEP----------------------------------------EKDEEPLPTDSEVP 375
                    |.|                                        |.:..|:..||::.
  Rat   391 GSRQCFLYPGPGGGYGFRLRCVASGPCLFISQVTPGGSAARAGLQMGDAILEVNGCPVGGDSDLD 455

  Fly   376 NLEQLPETELPDEQPEKSDAPKEVCEPEVVIQTEPGSPDGNEA 418
            .|:||.|                 .||.:.::..|.:..|:||
  Rat   456 TLQQLAE-----------------AEPPLRLKLAPRNSQGSEA 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 19/62 (31%)
DUF4749 653..>699 CDD:292558
Pdzd3NP_001178925.1 PDZ_signaling 47..127 CDD:238492 21/70 (30%)
PDZ_signaling 155..232 CDD:238492 15/79 (19%)
PDZ 260..345 CDD:214570 15/101 (15%)
PDZ_signaling 407..472 CDD:238492 10/81 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.