DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and CG10939

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_524712.1 Gene:CG10939 / 44155 FlyBaseID:FBgn0010620 Length:296 Species:Drosophila melanogaster


Alignment Length:260 Identity:50/260 - (19%)
Similarity:77/260 - (29%) Gaps:88/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKMCRFDNVPWGFRL----------VGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAA 59
            :|...||.  :||.|          :|..|.|.|           |:.|||:..|.|:.:|..:.
  Fly    26 VKRPDFDG--YGFNLHSEKVKPGQFIGKVDADSP-----------AEAAGLKEGDRILEVNGVSI 77

  Fly    60 TPLTH-----------DEAHRLIM--------------------GSGSVFYFGVYRENEEDAYEC 93
            ...||           :|...|::                    |:||.         .::.||.
  Fly    78 GSETHKQVVARIKAIANEVRLLLIDVDGKALEVKPASPPAAACNGNGSA---------SQNGYEG 133

  Fly    94 LK-KFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVD 157
            .| :.|.:..:::...|.:...|...|..|...|.||            .:|.......|||...
  Fly   134 TKQEMPGASANISSISMVSTKRSSNASSIQSGSTMNA------------SDLDVVDRGIPAVAAP 186

  Fly   158 VDVLAECRQPMSEVHSEEKRGDVNGHDAPGQADEGGL------------PVENLYLPDLPDRPCS 210
            |.:.....|..|:..|......:.....|..|.:.|:            ....:..|..|..|.|
  Fly   187 VAITPPPVQNGSKPSSPINNNTLMSTPPPPSATKAGINNNGSVYNTNGNGTNGMTTPTTPPPPTS 251

  Fly   211  210
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 22/110 (20%)
DUF4749 653..>699 CDD:292558
CG10939NP_524712.1 PDZ_signaling 20..101 CDD:238492 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.