DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and CG6688

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 / 42716 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster


Alignment Length:457 Identity:92/457 - (20%)
Similarity:154/457 - (33%) Gaps:162/457 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 WGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVFY 79
            :||:|.......|| .|.:|..|:.|...||:..|.::.:|......|...|..:::        
  Fly    39 YGFQLTRSKWDPYP-WVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMV-------- 94

  Fly    80 FGVYRENEEDAY-------ECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEPF 137
                 ::::|..       ||.|...|:  |:..:||||       ||.:|:....:..    ..
  Fly    95 -----KSQKDCVTILCWNSECDKDCDTN--SICCAPMPT-------SLRRLSLVLESIL----RL 141

  Fly   138 VPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDVNGHDAPGQADEGGLPVENLYLP 202
            |..|  :...|::.||:        :|:               |||               |...
  Fly   142 VECP--VCGVTISPPAM--------QCQ---------------NGH---------------LLCV 166

  Fly   203 DLPDRPCSALSERQEI---------KLVEEEIAAVLSGESEVLKEHNVLGVNFYRIFPKPGVCMS 258
            |     |...|||..:         .|:.|:|...::...|:.:..|.|....:....:|.|   
  Fly   167 D-----CRIRSERCPVCRDFYTPRRALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVV--- 223

  Fly   259 SDVLRSLNEEVTKTKLEKDKENRQWSTFLQRPNRPV-PKSK---QSLE---------AERRAANA 310
                              .:::|.......|..||| |.:|   :.||         :...||..
  Fly   224 ------------------GRQDRITGQDTWRKRRPVLPTNKFLTKLLEGCAYSTDNLSPSNAATL 270

  Fly   311 YKVTIVKSAPREKSPMPEAKPAPKEATPPKE------VEKKEEEP------VPEEVVEPEPEPEK 363
            .: |.......:.|.:| |:.:|..||||:.      ::.....|      :.:|.|:|..|...
  Fly   271 LR-TNTTDVAGDSSEIP-ARTSPVTATPPERTTMHATLDANAAHPSLSTNDLQQEGVKPNAEGVD 333

  Fly   364 DEE---------------PLPTDSEVPNLEQ---LPETELPDEQPEKSDAPKEVCEPEVVIQTEP 410
            :|.               |||. |..|.:.:   |....:|...|.: |.|::      |:||:|
  Fly   334 EESGTNSSHISATSLHGPPLPA-SVSPGINESSGLQPVRIPPVTPSQ-DLPQQ------VVQTKP 390

  Fly   411 GS 412
            .|
  Fly   391 AS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 15/59 (25%)
DUF4749 653..>699 CDD:292558
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 16/78 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.