DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and CG34375

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001163693.1 Gene:CG34375 / 42715 FlyBaseID:FBgn0085404 Length:568 Species:Drosophila melanogaster


Alignment Length:144 Identity:35/144 - (24%)
Similarity:60/144 - (41%) Gaps:33/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 KQLADLLPTIKLQQQEKQLPQIDENSGNEEQ-VEEGVTTATNTINTAGETEDAGKDISISGSDNP 538
            ||::..|.|:.:.|..:::.:..:....:|| |:|.|......|....: |.|.:..|..|.:|.
  Fly   237 KQISRQLETVLVDQSPREIRRKSQQGQEQEQAVQEAVLPRCTLIKVQHQ-EAAVEHFSEEGHNNM 300

  Fly   539 PVGP-----------CESNED--RCDANDREVAEISRSTDDNRLAKDKKKDLDQEQKQQQQQQQE 590
            .|.|           ...::|  |||    |||.|:...              |.|:|||||:::
  Fly   301 LVKPKLKLSKKSWRITGPDQDGLRCD----EVATINNGV--------------QVQEQQQQQERQ 347

  Fly   591 PLSEEQNFKKQKRH 604
            .|..|::...:..:
  Fly   348 QLGHEKSASSESEY 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558
CG34375NP_001163693.1 PDZ 13..86 CDD:238080
RING 129..168 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.