DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and loco

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_732773.1 Gene:loco / 42672 FlyBaseID:FBgn0020278 Length:1541 Species:Drosophila melanogaster


Alignment Length:556 Identity:107/556 - (19%)
Similarity:193/556 - (34%) Gaps:165/556 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FYFGVYRENEEDAYECLKKFPT-SEGSLTKSPMPTISPSPTPSLSQ---LTETTNARTPEPEPFV 138
            |:.|        |:..|||..: :|....||.:|....:.:.|..:   :.:..:|..|.|    
  Fly   967 FHLG--------AFSKLKKSASNAEDRRRKSLLPWHRKTRSKSRDRTEIMADMQHALMPAP---- 1019

  Fly   139 PLPRELAAATMAAPAVEVDVDVLAECRQ-PMSEVHSEEKRGDVNGHDAPGQADEG-GLPVENLY- 200
            |:|:.       ||.....:.::  |.| .:|::||  .|..::..|| |.|..| |...|::| 
  Fly  1020 PVPQN-------APLTSASLKLV--CGQNSLSDLHS--SRSSLSSFDA-GTATGGQGASTESVYS 1072

  Fly   201 -----LPD-----LPDRPCSALSERQEIKLVE----------------------EEIAAVLSGES 233
                 |.|     :..||...:.|..| :|:|                      ::.:.:|:|:.
  Fly  1073 LCRVILTDGATTIVQTRPGETVGELVE-RLLEKRNLVYPYYDIVFQGSTKSIDVQQPSQILAGKE 1136

  Fly   234 EVLKEHNVLGVNFYRIFPKPGVCMSSDVLRSLNEEVTKTKLEKDKENRQWSTFLQRP-------N 291
            .|::..    |.|....|.|.|.......:....||.:..|.|.....:....:.|.       |
  Fly  1137 VVIERR----VAFKLDLPDPKVISVKSKPKKQLHEVIRPILSKYNYKMEQVQVIMRDTQVPIDLN 1197

  Fly   292 RPVPKSKQSLEAERRAANAYKVTIVKS----------APREKSPMPEAKPAPK----EATPPKEV 342
            :||..:    :.:|     .::.:|.|          .|::..||   ||.|:    |.|     
  Fly  1198 QPVTMA----DGQR-----LRIVMVNSDFQVGGGSSMPPKQSKPM---KPLPQGHLDELT----- 1245

  Fly   343 EKKEEEPVPEEVVEPEPEPEKDEEPLPTDSEVPNLEQLPETELPDEQPEKSDAPKEVCEPEVVIQ 407
                 ..|..|::..:.:....|:..|.|     |..:...|.|.|.....:..:          
  Fly  1246 -----NKVFNELLASKADAAASEKSRPVD-----LCSMKSNEAPSETSSLFERMR---------- 1290

  Fly   408 TEPGSPDGNEASDG---PAGATPPAEPITPVPVKSEEELALERQLADVQRQLAALSSLPSTIQST 469
                    .:..||   ||...|..:..:....:..||.|..:.:||.::.:.|.......:|.|
  Fly  1291 --------RQQRDGGNIPASKLPKLKKKSTSSSQQSEEAATTQAVADPKKPIIAKLKAGVKLQVT 1347

  Fly   470 LDAVTKQLADLLPTIKLQQQEKQLPQIDENSGNEEQVE--------EGVTTATNTIN-------- 518
             :.|.:...:||..:|    ..||.::::..|.|...:        |.::.|.:.:.        
  Fly  1348 -ERVAEHQDELLEGLK----RAQLARLEDQRGTEINFDLPDFLKNKENLSAAVSKLRKVRASLSP 1407

  Fly   519 ------TAGETEDAGKDISISGSDNPPVGPCESNED 548
                  |..|.......:||:.|.. ||.|.:.:::
  Fly  1408 VSKVPATPTEIPQPAPRLSITRSQQ-PVSPMKVDQE 1442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558
locoNP_732773.1 PDZ_signaling 69..145 CDD:238492
PTB_RGS12 251..391 CDD:269984
RGS_R12-like 828..941 CDD:188661
RGS12_RBD 1073..1145 CDD:176412 12/76 (16%)
RBD 1144..1213 CDD:128731 13/77 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.