DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and pdlim4

DIOPT Version :10

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_989251.1 Gene:pdlim4 / 394862 XenbaseID:XB-GENE-1001790 Length:332 Species:Xenopus tropicalis


Alignment Length:261 Identity:64/261 - (24%)
Similarity:100/261 - (38%) Gaps:65/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
            |||||||||.||:.|||:.|:..||.|:.|.|...|:|:.||......:.|..|...|.......
 Frog    12 PWGFRLVGGRDYNTPLTISKINPGSKAELANLYPGDVILEINGENTENMNHLVAQNKIKACTDQL 76

  Fly    79 YFGVYRE------NEEDAYECLKK----------FPTSEGSLTKSPMPTISPSPTPS-------- 119
            ...:.|.      |||:.....:|          ||| |.:.|:...| :||..:||        
 Frog    77 MLSINRRDGRTLLNEEELKRQQRKYSLEAELQDIFPT-EITQTRRSAP-VSPRGSPSDSRQIPLQ 139

  Fly   120 ------------------LSQLTETTNARTPEP-EPFVPLPRELAAATMAAPAVEVDVDVLAECR 165
                              ||......|..:|:. :||..:|:       :...::.:.||....:
 Frog   140 QYNNPSKLYTNNNNIEANLSSHMARINLSSPQSVDPFRSVPK-------SKNGIDTESDVYKMLQ 197

  Fly   166 QPMSEVHSEEKRGDVNGHDAPGQADEGGLPVENLYLPDLPDRPCSALSERQEIKLVEEEIAAVLS 230
            ..:..|...::.|.........:|.|.|         :.|:||.|:    :.||....::::.|.
 Frog   198 DYVEPVSQPKQSGSFKYLQDMLEAGENG---------EKPERPPSS----RNIKSPVSKLSSPLP 249

  Fly   231 G 231
            |
 Frog   250 G 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_ZASP52-like 4..84 CDD:467281 27/69 (39%)
DUF4749 653..>699 CDD:464948
pdlim4NP_989251.1 PDZ_PDLIM-like 4..82 CDD:467235 27/69 (39%)
DUF4749 139..231 CDD:464948 15/107 (14%)
LIM_RIL 257..309 CDD:188835
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.