DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Dlg5

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_609505.1 Gene:Dlg5 / 34573 FlyBaseID:FBgn0032363 Length:1916 Species:Drosophila melanogaster


Alignment Length:606 Identity:120/606 - (19%)
Similarity:198/606 - (32%) Gaps:222/606 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 MGSGSVFYFGVYRENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEP 136
            :|||:.:|||              |....:||.::            .|::|.:..|....|.|.
  Fly   157 VGSGNPYYFG--------------KTQGCDGSCSE------------KLAELKKERNMVAVEREK 195

  Fly   137 FVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDVNGHDAPGQADEGGLPVENLYL 201
            :.....||          |.|.:...|             |||                 ||..|
  Fly   196 YKKSYIEL----------EKDRNYYRE-------------RGD-----------------ENQKL 220

  Fly   202 PDLPDRPCSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVNFYRIFPKPGVCMSSDVLRSLN 266
            ..|..:      |.:.:..:.||:..:||.:..||:||..:                ||.|...|
  Fly   221 KVLLSQ------ESKNVLSLTEELNQLLSEKDNVLQEHQKM----------------SDDLVLAN 263

  Fly   267 EEVTKTKLEKDKE-NRQWSTFLQRPNRPVPKSKQSLEAERRAANAYKVTIVKSAPREKSPMPEAK 330
            :|:  .:|:||:: .|.....||..|                |:..|..::||  |:.|...|. 
  Fly   264 KEI--ERLKKDEQLARAEIKVLQLAN----------------ADLKKRDLLKS--RDSSWSKEF- 307

  Fly   331 PAPKEATPPKEVEK--KEEEPVPEEVVEPEPEPEKDEEPLPTDSEVPNLEQLPETELPDEQPEKS 393
            |:.||....||:||  |..|....||.....:.|  |.....|..:...|::         .::.
  Fly   308 PSGKELENSKELEKLRKSLEKALSEVERSSQDAE--EAKRVRDWAISQREKI---------VQER 361

  Fly   394 DAPKEVCEPEVVIQTEPGSPDGNEASDGPAGATPPAEPITPVPVKSEEELALERQLADVQRQLAA 458
            |:.|.:|:                                  .::.|.:.|:...|..::..   
  Fly   362 DSVKTLCD----------------------------------KMRHERDKAISDSLMAIRDS--- 389

  Fly   459 LSSLPSTIQSTLDAVTKQLADLLPTIKLQQQEKQLPQIDEN-SGN-----------EEQVEEGVT 511
                 ..|:...|...|:: |||.. :::|||:|  .:|.| ||:           |:.:|..::
  Fly   390 -----EKIKKQKDEAQKKI-DLLKE-QMEQQERQ--NLDSNASGSRRSFRPSSYEGEDLLEVELS 445

  Fly   512 TATNTINTAGETEDAGKDISISG--SDNPPVGPCESNEDRCDAND-------------------- 554
            ...:|.:.....:|:.|...:.|  |.:|..|..:.|:..|..|:                    
  Fly   446 GYEHTSDLGIILDDSNKRKLVCGVTSSSPACGKLKINDVICKVNNLDCQSLSKRMVLDEIRACAP 510

  Fly   555 REVAEISRSTDDNRLAKD---KKKDLDQEQKQQQQQQQEPLSEEQNFK----------------K 600
            |.:..:||:....|.|..   |.:|.|.....|..........|||..                .
  Fly   511 RSLLLVSRTRHSKRHAYSVQLKTRDRDCPHGLQLDMGVFIAKIEQNSLAFYEPELDVGDRVLSIN 575

  Fly   601 QKRHDVIEELEEHLVRKNNPR 621
            .|..|.::.:||.:...|:||
  Fly   576 NKSMDSVQSIEEVMQLMNDPR 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 1/2 (50%)
DUF4749 653..>699 CDD:292558
Dlg5NP_609505.1 AAA_23 <165..333 CDD:290211 59/276 (21%)
CENP-F_leu_zip 229..360 CDD:287450 42/178 (24%)
DUF1090 <326..408 CDD:284007 19/135 (14%)
PDZ_signaling 439..516 CDD:238492 12/76 (16%)
PDZ_signaling 533..592 CDD:238492 10/58 (17%)
PDZ_signaling 1290..1369 CDD:238492
PDZ_signaling 1497..1576 CDD:238492
SH3_DLG5 1594..1657 CDD:212794
Guanylate_kin 1737..1904 CDD:279019
NK <1773..1905 CDD:302627
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.