DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Prickle4

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_038940411.1 Gene:Prickle4 / 316212 RGDID:1563979 Length:368 Species:Rattus norvegicus


Alignment Length:405 Identity:79/405 - (19%)
Similarity:115/405 - (28%) Gaps:177/405 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 EPEPEKDEEPLPTDSEVPNLEQLPETELPDEQPEKSDAPKEVCEPEVVIQTEPGSPDGNEASDGP 422
            ||:|     |:.|||:..:.......::..:.|..|             ...|..||.::||:.|
  Rat    19 EPDP-----PVNTDSDSGHRPVQGYGDISVQAPTSS-------------SLGPPCPDISQASNWP 65

  Fly   423 AGAT-----PPAEPITPVPVKSEEELAL---ERQLADV-----QRQLAALSS-----LPSTIQS- 468
            ...|     ||.:        |:|...|   |.:||.:     ||:..:|..     ||..::. 
  Rat    66 GFRTLLQQLPPQD--------SDERYCLALGEEELAQLRLFCAQRKQKSLGQGVARLLPPKLEGH 122

  Fly   469 TLDAVTKQL--------------------------------------------------ADLLPT 483
            |.:...|.|                                                  |:||  
  Rat   123 TCEKCKKLLNPGEYGVFAARAGERCCWHRPCFACQACGQALTNLIYFYHDGHLYCGRHHAELL-- 185

  Fly   484 IKLQQQEKQLPQIDENSGNEEQVE-EGVTTATN--TINTAGETEDAGKDISISGSDNPP------ 539
                  ..:.|..|:...::...| ||.....|  ......|..|.|:.....||...|      
  Rat   186 ------RPRCPACDQLIFSQRCTEAEGRHWHENHFCCQDCAEPLDGGRYALPGGSPCCPSCFARR 244

  Fly   540 --------VGPCE------SNEDRCDANDREVAEISRSTDDNRLAKDKKKDLDQEQKQQQQQQQE 590
                    :|..|      :..|..|.|.||                ::..|..|......|...
  Rat   245 YRSGGSSSIGAAEGQASLGNGGDGADLNGRE----------------QRLGLSMEGGNLPGQNPS 293

  Fly   591 PLSEEQNFKKQKRHDVIEE--LEEHLVRKNNP-------RRSKRAF------GPLVP-------- 632
            |          ..|.|:::  |::|||....|       |.|.||.      |||.|        
  Rat   294 P----------HTHAVLQQPLLQQHLVHPPQPPDASIGARSSHRASLACELQGPLEPTRRGCGAG 348

  Fly   633 -SSERPLVLP-GGRR 645
             :.:|....| ||||
  Rat   349 LAPKRGRRSPTGGRR 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558
Prickle4XP_038940411.1 PET_OEBT 1..116 CDD:193603 27/122 (22%)
LIM1_Testin_like 124..181 CDD:188726 2/56 (4%)
LIM2_Testin_like 187..241 CDD:188727 12/53 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.