DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Pdlim7

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:XP_038951356.1 Gene:Pdlim7 / 286908 RGDID:628769 Length:464 Species:Rattus norvegicus


Alignment Length:424 Identity:88/424 - (20%)
Similarity:136/424 - (32%) Gaps:150/424 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
            ||||||.||.|::.||::.::|.|..|.:||:.|.|.::.|:...|..|||.||...|...|...
  Rat    13 PWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERL 77

  Fly    79 YFGVYRENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEPFVPLPRE 143
            ..|:.|                             ..|..|..|     .|.||..:|    ||.
  Rat    78 SLGLSR-----------------------------AQPAQSKPQ-----KALTPPADP----PRY 104

  Fly   144 LAAATMAAPAVEVDVDVLAECRQPMSEVHSEEKRGDVNGHDAPGQADEGGLPVENLYLPDLPDRP 208
            ..|.:.:          |.:..:|..               ||...|..           |....
  Rat   105 TFAPSAS----------LNKTARPFG---------------APPPTDSA-----------LSQNG 133

  Fly   209 CSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVNFYRIFPKPGVCMSSD--VLRSLNEEVTK 271
            |..|:.:|.::.:..:.:          |:..:.....:|  |:||...|..  :|..|..  |:
  Rat   134 CRPLTSQQLLRQLVPDAS----------KQRLMENTEDWR--PRPGTGQSRSFRILAHLTG--TE 184

  Fly   272 TKLEKDKENRQWSTFLQRPNRPVPKSKQSLEAERRAANAYKVTIVKSAPREKSPMPEAKPAPKEA 336
            ...:.|:|..:.|:.:.|...|.|.|                    :.|:|..|.| ..|:| .:
  Rat   185 FMQDPDEEFMKKSSQVPRTEAPAPAS--------------------TIPQESWPGP-TTPSP-TS 227

  Fly   337 TPPKEVEKKEEEPVPEEVVEPEPEPEKDEEPLPTDSEVPNLEQLPETELPDEQPEKSDAPKEVCE 401
            .||..|:....|         ...|:|....|...|:       |.|..|.:....         
  Rat   228 RPPWAVDPAFAE---------RYAPDKTSTVLTRHSQ-------PATPTPLQNRTS--------- 267

  Fly   402 PEVVIQTEPGSPDGNEASDGPAGATPPAEPITPV 435
               ::|...|...|..:::|.          |||
  Rat   268 ---IVQAAAGGGTGGGSNNGK----------TPV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 26/60 (43%)
DUF4749 653..>699 CDD:292558
Pdlim7XP_038951356.1 PDZ_signaling 5..79 CDD:238492 27/65 (42%)
PHA03247 <11..261 CDD:223021 80/373 (21%)
DUF4749 <163..192 CDD:406377 9/32 (28%)
LIM1_Enigma 289..340 CDD:188836 88/424 (21%)
LIM2_Enigma 348..399 CDD:188840
LIM3_Enigma 407..461 CDD:188842
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.