DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and PDLIM3

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_055291.2 Gene:PDLIM3 / 27295 HGNCID:20767 Length:364 Species:Homo sapiens


Alignment Length:288 Identity:59/288 - (20%)
Similarity:101/288 - (35%) Gaps:94/288 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDE--------AHRL 70
            ||||||.||.|::.||.:.::|.||.|..|.|...|:|:.|:......:||.:        ||:|
Human    12 PWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAAAHQL 76

  Fly    71 IM-----------------GSGSVFYFGVYRENEEDAY----ECLKKFP-----TSEGSLTKSPM 109
            .:                 |....|...:..|.::..|    ..::..|     .|.|..|.|.:
Human    77 CLKIDRGETHLWSPQVSEDGKAHPFKINLESEPQDGNYFEHKHNIRPKPFVIPGRSSGCSTPSGI 141

  Fly   110 PTISPSPTPSLSQLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVDVDVLAECRQPMSEVHSE 174
            ...|...|||......|.            .|.:|..|...||.:.:::::     ..:..||::
Human   142 DCGSGRSTPSSVSTVSTI------------CPGDLKVAAKLAPNIPLEMEL-----PGVKIVHAQ 189

  Fly   175 EKRGDVNGHDAPGQADEGGLPVENLYLPDLPDRPCSALSERQEIKLVEEEIAAVLSGESEVLKEH 239
            .                              :.|....|:...::.::.:::..| ||:.::.| 
Human   190 F------------------------------NTPMQLYSDDNIMETLQGQVSTAL-GETPLMSE- 222

  Fly   240 NVLGVNFYRIFPKPGVCMSSDVLRSLNE 267
                       |...|...|||.|.|::
Human   223 -----------PTASVPPESDVYRMLHD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 26/85 (31%)
DUF4749 653..>699 CDD:292558
PDLIM3NP_055291.2 PDZ_signaling 2..80 CDD:238492 25/67 (37%)
DUF4749 184..263 CDD:374237 15/99 (15%)
LIM_ALP 294..346 CDD:188834
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10447
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.