Sequence 1: | NP_648358.2 | Gene: | Zasp67 / 39148 | FlyBaseID: | FBgn0036044 | Length: | 730 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380800.1 | Gene: | Pdlim4 / 24915 | RGDID: | 3575 | Length: | 335 | Species: | Rattus norvegicus |
Alignment Length: | 281 | Identity: | 75/281 - (26%) |
---|---|---|---|
Similarity: | 106/281 - (37%) | Gaps: | 74/281 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
Fly 79 YFGVYR-ENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNAR------------ 130
Fly 131 -----TPEPEP------------FVPLPRELAAATMAAP---------------AVEVDVDVLAE 163
Fly 164 CRQPMSEVHSEEKR-GDVNGHDAPGQADEGGLPVENLYLPDLPDRPCSALSERQEIKLVEEEIAA 227
Fly 228 VLSGESEVLKE-----HNVLG 243 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp67 | NP_648358.2 | PDZ_signaling | 2..75 | CDD:238492 | 29/60 (48%) |
DUF4749 | 653..>699 | CDD:292558 | |||
Pdlim4 | NP_001380800.1 | PDZ_signaling | 2..80 | CDD:238492 | 29/67 (43%) |
DUF4749 | 139..235 | CDD:406377 | 22/107 (21%) | ||
LIM_RIL | 260..312 | CDD:188835 | 2/10 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24214 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |