DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and Pdlim4

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001380800.1 Gene:Pdlim4 / 24915 RGDID:3575 Length:335 Species:Rattus norvegicus


Alignment Length:281 Identity:75/281 - (26%)
Similarity:106/281 - (37%) Gaps:74/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PWGFRLVGGADYDYPLTVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVF 78
            |||||||||.|:..|||:.:|..||.|..|.|...|:|..||..:...:||.||...|.|.....
  Rat    12 PWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIKGCHDHL 76

  Fly    79 YFGVYR-ENEEDAYECLKKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNAR------------ 130
            ...|.| ||        |.:|:|.....::....|.|....||.|......:|            
  Rat    77 TLSVSRPEN--------KNWPSSPDDKAQAHRIHIDPEAQASLLQDGSPATSRRSSISGISLEDN 133

  Fly   131 -----TPEPEP------------FVPLPRELAAATMAAP---------------AVEVDVDVLAE 163
                 :|..:|            .|.||.:::|..::.|               .|::..:|...
  Rat   134 RSGLGSPYGQPPRLPVPHNGSSNEVTLPSQMSALHVSPPPSADTPRILPRNRDCRVDLGSEVYRM 198

  Fly   164 CRQPMSEVHSEEKR-GDVNGHDAPGQADEGGLPVENLYLPDLPDRPCSALSERQEIKLVEEEIAA 227
            .|:|.....||.|: |.........:|.|||            |||.|..|  :.:|....::.|
  Rat   199 LREPAEPAASEPKQSGSFRYLQGMLEAGEGG------------DRPGSGGS--RNLKPAASKLGA 249

  Fly   228 VLSGESEVLKE-----HNVLG 243
            .||| .:.|.|     |.::|
  Rat   250 PLSG-LQGLPECTRCGHGIVG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 29/60 (48%)
DUF4749 653..>699 CDD:292558
Pdlim4NP_001380800.1 PDZ_signaling 2..80 CDD:238492 29/67 (43%)
DUF4749 139..235 CDD:406377 22/107 (21%)
LIM_RIL 260..312 CDD:188835 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24214
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.