DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zasp67 and C50F7.3

DIOPT Version :9

Sequence 1:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_501268.1 Gene:C50F7.3 / 183682 WormBaseID:WBGene00016843 Length:313 Species:Caenorhabditis elegans


Alignment Length:350 Identity:64/350 - (18%)
Similarity:109/350 - (31%) Gaps:112/350 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TVVKVTEGSIADEAGLRVEDIIVRINDTAATPLTHDEAHRLIMGSGSVFYFGVYRENEEDAYECL 94
            ||||.     .|..|:.::..:| ::....:|.|     .||.....:.|...|:..        
 Worm    31 TVVKA-----EDNIGIELKSSVV-VSIPFESPWT-----GLIKVGDILVYLNGYQIG-------- 76

  Fly    95 KKFPTSEGSLTKSPMPTISPSPTPSLSQLTETTNARTPEPEPFVPLPRELAAATMAAPAVEVDVD 159
                 .:|.|.:.....|:..|...::..........|.|..|.||.:..:.:|        |..
 Worm    77 -----GQGVLARFIQTIINGQPCAKMTYKVIRFKRHIPRPSGFPPLQKHESYST--------DTL 128

  Fly   160 VLAECRQ------PMSEVHS--------EEKRGDVNGHDAPGQADEGGLPVENLYLPDLPDRP-- 208
            ||...::      .:.|:..        |...||:.........|..|            ::|  
 Worm   129 VLYNLKKVFHLGLDIKEIEGKIVVCDLVENSLGDMTFSVGETILDVDG------------EKPLS 181

  Fly   209 CSALSERQEIKLVEEEIAAVLSGESEVLKEHNVLGVNFYRIFPKPGVCMSSDVLRS-LNEEVTKT 272
            |:..:||..              :|.:::.:.::.|..          .|:|.|:: |..::|||
 Worm   182 CTGFNERVR--------------KSLLIRNYCLVTVEI----------PSTDPLKNLLRNQITKT 222

  Fly   273 --------KLEKDKE---------------NRQWSTFLQRPNRPVPKSKQSLEAERRAANAYKVT 314
                    ||..|..               ..|....|..  .|:|||.:|..::.:.....|..
 Worm   223 VKEAPRIHKLPPDAAAYGAEGIAVLRKFGGGEQLKPILLA--EPIPKSNESAHSQLKIEEKVKEG 285

  Fly   315 IVKSA--PREKSPMPEAKPAPKEAT 337
            .|.|.  .|....:|..|.|..|:|
 Worm   286 DVPSGWNSRLFVRLPPMKSAETEST 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492 11/44 (25%)
DUF4749 653..>699 CDD:292558
C50F7.3NP_501268.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.