Sequence 1: | NP_648358.2 | Gene: | Zasp67 / 39148 | FlyBaseID: | FBgn0036044 | Length: | 730 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493661.1 | Gene: | txt-1 / 183651 | WormBaseID: | WBGene00016807 | Length: | 152 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 47/202 - (23%) |
---|---|---|---|
Similarity: | 70/202 - (34%) | Gaps: | 66/202 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 530 ISISGSDNPPVGPCESNEDRCDANDREVAEISRSTDDNR-LAKDKKKDLDQEQKQQQQQQQEPLS 593
Fly 594 EEQNFKKQKRHDVIEELEEHLVRKNNPRRSKRAFGPLVPSSERPLVLPGGRRWYRPKDAYNDEFI 658
Fly 659 AETLSAQAELITGSTLGVNFMKYQKPERKIDLNRSEVYKYLNPHL-DRAPVRGIEVRAPLVAAES 722
Fly 723 DIRQSLQ 729 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Zasp67 | NP_648358.2 | PDZ_signaling | 2..75 | CDD:238492 | |
DUF4749 | 653..>699 | CDD:292558 | 9/45 (20%) | ||
txt-1 | NP_493661.1 | PDZ_signaling | 45..>100 | CDD:238492 | 15/90 (17%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |